Skip to product information
1 of 1

Gene Bio Systems

Recombinant Sheep Interleukin-1 beta(IL1B)

Recombinant Sheep Interleukin-1 beta(IL1B)

SKU:CSB-EP011614SH

Regular price $1,271.00 USD
Regular price Sale price $1,271.00 USD
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: Others

Target / Protein: IL1B

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Ovis aries (Sheep)

Delivery time: 3-7 business days

Uniprot ID: P21621

AA Sequence: AAVQSVKCKLQDREQKSLVLDSPCVLKALHLPSQEMSREVVFCMSFVQGEERDNKIPVALGIRDKNLYLSCVKKGDTPTLQLEEVDPKVYPKRNMEKRFVFYKTEIKNTVEFESVLYPNWYISTSQIEEKPVFLGRFRGGQDITDFRMETLSP

Tag info: N-terminal 6xHis-tagged

Expression Region: 114-266aa

Protein length: Full Length of Mature Protein

MW: 21.7 kDa

Alternative Name(s):

Relevance: Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.

Reference: Molecular cloning and characterization of ovine IL-1 alpha and IL-1 beta.Andrews A.E., Barcham G.J., Brandon M.R., Nash A.D.Immunology 74:453-460(1991)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details