Skip to product information
1 of 1

Gene Bio Systems

Recombinant Sheep C-X-C chemokine receptor type 4(CXCR4)

Recombinant Sheep C-X-C chemokine receptor type 4(CXCR4)

SKU:CSB-CF638935SH

Regular price $1,632.00 USD
Regular price Sale price $1,632.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Ovis aries (Sheep)

Uniprot NO.:Q28553

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:YTEDDLGSGDYDSMKEPCFREENAHFNRIFLPTVYSIIFLTGIVGNGLVILVMGYQKKLR SMTDKYRLHLSVADLLFVLTLPFWAVDAVANWYFGQFLCKAVHVIYTVNLYSSVLILAFI SLDRYLAIVHATNSQRPRKLLAEKVVYVGVWLPAVLLTIPDLIFADIKEADERYICDRFY PSDLWLVVFQFQ

Protein Names:Recommended name: C-X-C chemokine receptor type 4 Short name= CXC-R4 Short name= CXCR-4 Alternative name(s): Fusin Leukocyte-derived seven transmembrane domain receptor Short name= LESTR Stromal cell-derived factor 1 r

Gene Names:Name:CXCR4 Synonyms:LESTR

Expression Region:1-192

Sequence Info:full length protein

View full details