Skip to product information
1 of 1

GeneBio Systems

Recombinant Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein (S) (I332V,G339H,K356T,S371L,S373P,S375F,R403K,K417N,N440K,V445H,G446S,N450D,L452M,N460K,S477N,T478K,N481K,△483,E484K,F486P,G496S,Q498R,N501Y,Y505H), partial

Recombinant Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein (S) (I332V,G339H,K356T,S371L,S373P,S375F,R403K,K417N,N440K,V445H,G446S,N450D,L452M,N460K,S477N,T478K,N481K,△483,E484K,F486P,G496S,Q498R,N501Y,Y505H), partial

SKU:P0DTC2

Regular price $580.00 USD
Regular price Sale price $580.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Cancer

Uniprot ID: P0DTC2

Gene Names: S

Alternative Name(s): S glycoprotein;E2;Peplomer protein

Abbreviation: Recombinant SARS-CoV-2 S protein (Mutant type), partial

Organism: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)

Source: E.coli

Expression Region: 315-535aa(I332V,G339H,K356T,S371L,S373P,S375F,R403K,K417N,N440K,V445H,G446S,N450D,L452M,N460K,S477N,T478K,N481K,△483,E484K,F486P,G496S,Q498R,N501Y,Y505H)

Protein Length: Partial

Tag Info: Tag-Free

Target Protein Sequence: MTSNFRVQPTESIVRFPNVTNLCPFHEVFNATRFASVYAWNRTRISNCVADYSVLYNLAPFFTFKCYGVSPTKLNDLCFTNVYADSFVIKGDEVRQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSKHSGNYDYMYRLFRKSKLKPFERDISTEIYQAGNKPCKGKGPNCYFPLQSYSFRPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVK

MW: 25.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. The major receptor is host ACE2. When S2/S2' has been cleaved, binding to the receptor triggers direct fusion at the cell membrane. When S2/S2' has not been cleaved, binding to the receptor results in internalization of the virus by endocytosis leading to fusion of the virion membrane with the host endosomal membrane. Alternatively, may use NRP1/NRP2 and integrin as entry receptors. The use of NRP1/NRP2 receptors may explain the tropism of the virus in human olfactory epithelial cells, which express these molecules at high levels but ACE2 at low levels. The stalk domain of S contains three hinges, giving the head unexpected orientational freedom. ; [Spike protein S2]: Precursor of the fusion protein processed in the biosynthesis of the S protein and the formation of virus particle. Mediates fusion of the virion and cellular membranes by functioning as a class I viral fusion protein. Contains two viral fusion peptides that are unmasked after cleavage. The S2/S2' cleavage occurs during virus entry at the cell membrane by host TMPRSS2 or during endocytosis by host CSTL. In either case, this triggers an extensive and irreversible conformational change leading to fusion of the viral envelope with the cellular cytoplasmic membrane, releasing viral genomic RNA into the host cell cytoplasm. Under the current model, the protein has at least three conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During fusion of the viral and target cell membranes, the coiled coil regions (heptad repeats) adopt a trimer-of-hairpins structure and position the fusion peptide in close proximity to the C-terminal region of the ectodomain. Formation of this structure appears to promote apposition and subsequent fusion of viral and target cell membranes. ; [Spike protein S2']: Subunit of the fusion protein that is processed upon entry into the host cell. Mediates fusion of the virion and cellular membranes by functioning as a class I viral fusion protein. Contains a viral fusion peptide that is unmasked after S2 cleavage. This cleavage can occur at the cell membrane by host TMPRSS2 or during endocytosis by host CSTL. In either case, this triggers an extensive and irreversible conformational change that leads to fusion of the viral envelope with the cellular cytoplasmic membrane, releasing viral genomic RNA into the host cell cytoplasm. Under the current model, the protein has at least three conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During fusion of the viral and target cell membranes, the coiled coil regions (heptad repeats) adopt a trimer-of-hairpins structure and position the fusion peptide in close proximity to the C-terminal region of the ectodomain. Formation of this structure appears to promote apposition and subsequent fusion of viral and target cell membranes.

Reference:

Function:

View full details