Skip to product information
1 of 1

Gene Bio Systems

Recombinant Serratia proteamaculans Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF(arnF)

Recombinant Serratia proteamaculans Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF(arnF)

SKU:CSB-CF425676STJ

Regular price $1,717.00 USD
Regular price Sale price $1,717.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Serratia proteamaculans (strain 568)

Uniprot NO.:A8GDS1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRGYAWGAASVLLVTLAQLLMKWGMAQIPLMSFADVTLNLFMQYWLPLVVVSGGIFGYAL SMLCWFFALHHLPLNRAYPLLSVSYALVYLAAVILPWFNESATLLKTLGTLFILFGVWLI NSQAKVKTPQ

Protein Names:Recommended name: Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Short name= L-Ara4N-phosphoundecaprenol flippase subunit ArnF Alternative name(s): Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF

Gene Names:Name:arnF Ordered Locus Names:Spro_2160

Expression Region:1-130

Sequence Info:full length protein

View full details