Gene Bio Systems
Recombinant Sclerotinia sclerotiorum Signal peptidase complex catalytic subunit sec11(sec11)
Recombinant Sclerotinia sclerotiorum Signal peptidase complex catalytic subunit sec11(sec11)
SKU:CSB-CF412278STG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) (White mold) (Whetzelinia sclerotiorum)
Uniprot NO.:A7E716
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLSFLQNPRQAAAQVLNFALILSTAFMMWKGLSVASDSPSPIVVVLSGSMEPAFQRGDLL FLWNRNLLEETKVGEIVVYNVKGKDIPIVHRLVRKFGAGPKAKLLTKGDNNVADDTELYA RGQDYIEREDIIGSVVGYIPFVGYVTILLSEHPWLKTVMLGMMGLVVVLQRE
Protein Names:Recommended name: Signal peptidase complex catalytic subunit sec11 EC= 3.4.21.89 Alternative name(s): Signal peptidase I
Gene Names:Name:sec11 ORF Names:SS1G_01092
Expression Region:1-172
Sequence Info:full length protein
