Skip to product information
1 of 1

Gene Bio Systems

Recombinant Schizosaccharomyces pombe V-type ATPase assembly factor pkr1(pkr1)

Recombinant Schizosaccharomyces pombe V-type ATPase assembly factor pkr1(pkr1)

SKU:CSB-CF868462SXV

Regular price $1,721.00 USD
Regular price Sale price $1,721.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:Q9P7Y3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSYWVELWESIFTPGVTPVLAKSAHVACGALVAVFLGLYIGTKSIHCLILFFLAICLWLS LTWFLVELAHARVNNDLQMSSQSANKNDDNSNNQNPSNNKEMSDKESDSATTTQTFSVPE ELLRARTTANNS

Protein Names:Recommended name: V-type ATPase assembly factor pkr1

Gene Names:Name:pkr1 ORF Names:SPBP23A10.02

Expression Region:1-132

Sequence Info:full length protein

View full details