Recombinant Schizosaccharomyces pombe Uncharacterized protein C191.03c(SPCC191.03c)

CSB-CF896956SXV

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:Q9Y7P7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRSNNSSLVHCCWVSPPSLTRLPAFPSPRILSPCYCYNKRIRPFRGLTSYRQASYSLGFP LGLLVFLHSLIVARFFVASKSRSCIVRSLLFWINLDSADSRISVLFQCFFCIDIWTV

Protein Names:Recommended name: Uncharacterized protein C191.03c

Gene Names:ORF Names:SPCC191.03c

Expression Region:1-117

Sequence Info:full length protein