Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Uniprot NO.:G2TRT9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MQLNRSNKNLARRNVPYSKVFYLHSLKTSVRTKRINLKNIHSYLNAENCNDKKNFFFLSK TISFTNFVASNHLNKKIPIRLDKLNGLTLLTKKNFFFFFFFFTTITYSQSLRYTLLLIVF LFF
Protein Names:Recommended name: Putative uncharacterized protein C794.16
Gene Names:ORF Names:SPCC794.16
Expression Region:1-123
Sequence Info:full length protein