Skip to product information
1 of 1

Gene Bio Systems

Recombinant Schizosaccharomyces pombe Putative uncharacterized membrane protein C622.06c (SPCC622.06c)

Recombinant Schizosaccharomyces pombe Putative uncharacterized membrane protein C622.06c (SPCC622.06c)

SKU:CSB-CF527236SXV

Regular price $1,550.00 USD
Regular price Sale price $1,550.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:O94596

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSPKESIELQEFQSLLQDEAYEELINKKTYEAIKYRSNDGILPIIITLFIFSFVISRMII FFISLFNKNTYCELPAVADAIINSIALVCIIVILYFSSRKLNVEIRRGEVEDYRANLERN QR

Protein Names:Recommended name: Putative uncharacterized membrane protein C622.06c

Gene Names:ORF Names:SPCC622.06c

Expression Region:1-122

Sequence Info:full length protein

View full details