
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Uniprot NO.:O94592
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAANISKLEAIIDNTPNSSPDPEVSHKLWVSSLNKFQYTLPLLISNFAGLGIAFIYCLIA FIREMSHPSSRKDTMEHGLPIILCSTLMLVGNILYYFLSKHPLKVTVPEDLVQIPMQQMS SPAQEAP
Protein Names:Recommended name: Putative uncharacterized membrane protein C622.02
Gene Names:ORF Names:SPCC622.02
Expression Region:1-127
Sequence Info:full length protein
You may also like
-
Recombinant Schizosaccharomyces pombe Putative uncharacterized membrane protein C622.04 (SPCC622.04)
- Regular price
- $1,585.00 USD
- Sale price
- $1,585.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Schizosaccharomyces pombe Uncharacterized membrane protein C622.01c (SPCC622.01c)
- Regular price
- $1,594.00 USD
- Sale price
- $1,594.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Schizosaccharomyces pombe Putative uncharacterized membrane protein C622.07 (SPCC622.07)
- Regular price
- $1,571.00 USD
- Sale price
- $1,571.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Schizosaccharomyces pombe Putative uncharacterized membrane protein C622.06c (SPCC622.06c)
- Regular price
- $1,564.00 USD
- Sale price
- $1,564.00 USD
- Regular price
-
- Unit price
- per
Sold out