Skip to product information
1 of 1

Gene Bio Systems

Recombinant Schizosaccharomyces pombe Probable CAAX prenyl protease 2 (SPAC1687.02)

Recombinant Schizosaccharomyces pombe Probable CAAX prenyl protease 2 (SPAC1687.02)

SKU:CSB-CF530907SXV

Regular price $1,890.00 USD
Regular price Sale price $1,890.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:O94448

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRVYLISFFFTAIYVVSLYTFPVARPRPSLNRNDPKVITARCISVLLASSVCCILTRLII GPSLNVFTFPTDQVLKSLLHAATIFIGPLYEVWIVDKEYRLFFIHLKDCLSNAIAWRNII IGPLSEELTFRCCIVPICEAAGWSRLKIIFVAPLLFGMAHIHHTYEFLLAYPNAYIAAAL QTVVQFSYTTVFGWYTTHLFLSTHSLFPSFLVHAFCNSMGLPTLYGKIGNRNQTRIYYTL LLLGVLIFYMTWGITDFNNHQDFEPRLVPLN

Protein Names:Recommended name: Probable CAAX prenyl protease 2 EC= 3.4.22.- Alternative name(s): Prenyl protein-specific endoprotease 2 Short name= PPSEP 2

Gene Names:ORF Names:SPAC1687.02

Expression Region:1-271

Sequence Info:full length protein

View full details