Skip to product information
1 of 1

Gene Bio Systems

Recombinant Schizosaccharomyces pombe Microsomal signal peptidase subunit 1(new19)

Recombinant Schizosaccharomyces pombe Microsomal signal peptidase subunit 1(new19)

SKU:CSB-CF518820SXV

Regular price $1,654.00 USD
Regular price Sale price $1,654.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:G2TRR4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNYLEGTIDFAGQLRCQKYMNYGLCTSAVISYIYGYLVQDSYCVIKLFLILASLVALVCL PAWSMYNKNPLKFQKKKE

Protein Names:Recommended name: Microsomal signal peptidase subunit 1 EC= 3.4.-.-

Gene Names:Name:new19 ORF Names:SPBC887.22

Expression Region:1-78

Sequence Info:full length protein

View full details