Skip to product information
1 of 1

Gene Bio Systems

Recombinant Schizosaccharomyces pombe Ergosterol biosynthetic protein 28(erg28)

Recombinant Schizosaccharomyces pombe Ergosterol biosynthetic protein 28(erg28)

SKU:CSB-CF526744SXV

Regular price $1,726.00 USD
Regular price Sale price $1,726.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:O74820

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSQILAMLPDSLVAKWNVVVSVAALFNTVQSFLTPKLTKRVYSNTNEVNGLQGRTFGIWT LLSAIVRFYCAYHITNPDVYFLCQCTYYLACFHFLSEWLLFRTTNLGPGLLSPIVVSTVS IWFMAKEKASILGIAA

Protein Names:Recommended name: Ergosterol biosynthetic protein 28

Gene Names:Name:erg28 ORF Names:SPBC337.09

Expression Region:1-136

Sequence Info:full length protein

View full details