Skip to product information
1 of 1

Gene Bio Systems

Recombinant Schizosaccharomyces pombe Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit ost5(ost5)

Recombinant Schizosaccharomyces pombe Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit ost5(ost5)

SKU:CSB-CF515297SXV

Regular price $1,672.00 USD
Regular price Sale price $1,672.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:G2TRU0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSLNELIVAALKLFFYNKEQKSDCIFFCQVQIVIQISSSMFSLVIRRIHIRKLWYITVFT INASMFSGFFNNPSLLTPNENLLFQVGLHYSFAV

Protein Names:Recommended name: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit ost5 Short name= Oligosaccharyl transferase subunit ost5 EC= 2.4.1.119 Alternative name(s): Oligosaccharyl transferase subunit zeta

Gene Names:Name:ost5 ORF Names:SPCC18.19c

Expression Region:1-94

Sequence Info:full length protein

View full details