Gene Bio Systems
Recombinant Schizosaccharomyces pombe Cytochrome c oxidase assembly protein cox16, mitochondrial(cox16)
Recombinant Schizosaccharomyces pombe Cytochrome c oxidase assembly protein cox16, mitochondrial(cox16)
SKU:CSB-CF892235SXV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Uniprot NO.:Q9UTK1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:QAKKSPFIYVGLPFLSSVLLVWSCLIPISQVKFNRRDEQVKSLSRDAELDIIKRRRKVDV NEEYYRILLDQLNLQNEEYENKRVKRLKGEPTWEGNSSDKE
Protein Names:Recommended name: Cytochrome c oxidase assembly protein cox16, mitochondrial
Gene Names:Name:cox16 ORF Names:SPAC1486.08
Expression Region:13-113
Sequence Info:full length protein
