Gene Bio Systems
Recombinant Schizosaccharomyces pombe Cytochrome b-c1 complex subunit 10(qcr10)
Recombinant Schizosaccharomyces pombe Cytochrome b-c1 complex subunit 10(qcr10)
SKU:CSB-CF889232SXV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Uniprot NO.:Q9P7E0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MISFFPNKPMYHVQPHISFITPERTMKTIPAFSRWAFAAVAGVFVFAMQVPKVKTTILQP IAFIGDHFKDKTPEEDKWL
Protein Names:Recommended name: Cytochrome b-c1 complex subunit 10 Alternative name(s): Complex III subunit 10 Ubiquinol-cytochrome-c reductase complex subunit qcr10
Gene Names:Name:qcr10 ORF Names:SPBP4H10.08
Expression Region:1-79
Sequence Info:full length protein
