Skip to product information
1 of 1

Gene Bio Systems

Recombinant Salmonella typhimurium Spermidine export protein MdtI(mdtI)

Recombinant Salmonella typhimurium Spermidine export protein MdtI(mdtI)

SKU:CSB-CF762493SXB

Regular price $1,690.00 USD
Regular price Sale price $1,690.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

Uniprot NO.:Q7CQK0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQQFEWIHGAWLGLAIMLEIAANVLLKFSDGFRRKCYGILSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWVLFGQRLNPKGWVGVILLLAGMVMIKFA

Protein Names:Recommended name: Spermidine export protein MdtI

Gene Names:Name:mdtI Ordered Locus Names:STM1483

Expression Region:1-109

Sequence Info:full length protein

View full details