Skip to product information
1 of 1

Gene Bio Systems

Recombinant Salmonella typhimurium Homoserine-homoserine lactone efflux protein(rhtB)

Recombinant Salmonella typhimurium Homoserine-homoserine lactone efflux protein(rhtB)

SKU:CSB-CF867895SXB

Regular price $1,885.00 USD
Regular price Sale price $1,885.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

Uniprot NO.:Q9L6N6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTFEWWFAYLLTSTLLSLSPGSGAINTMTTSINHGYRGAVASIAGLQTGLGIHIVLVGVG LGTLFSRSLLAFEILKWAGAAYLIWLGIQQWRAAGAIDLHTLAQTQSRGRLFKRAIFVNL TNPKSIVFLAALFPQFIMPQQPQLAQYLILGVTTIVVDMVVMTGYATLAQRIAAWIKGPK QMKALNKAFGSLFMLVGALLASARHA

Protein Names:Recommended name: Homoserine/homoserine lactone efflux protein

Gene Names:Name:rhtB Ordered Locus Names:STM3960 ORF Names:STMD1.30

Expression Region:1-206

Sequence Info:full length protein

View full details