Skip to product information
1 of 1

Gene Bio Systems

Recombinant Salmonella schwarzengrund Electron transport complex protein RnfA(rnfA)

Recombinant Salmonella schwarzengrund Electron transport complex protein RnfA(rnfA)

SKU:CSB-CF474615SWV

Regular price $1,864.00 USD
Regular price Sale price $1,864.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Salmonella schwarzengrund (strain CVM19633)

Uniprot NO.:B4TV19

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLID TWILIPLDLIYLRTLAFILVIAVVVQFTEMVVRKTSPALYRLLGIFLPLITTNCAVLGVA LLNINLGHHFLQSALYGFSAAVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLM SLAFMGFSGLVKL

Protein Names:Recommended name: Electron transport complex protein RnfA

Gene Names:Name:rnfA Ordered Locus Names:SeSA_A1557

Expression Region:1-193

Sequence Info:full length protein

View full details