Skip to product information
1 of 1

Gene Bio Systems

Recombinant Salmonella paratyphi C Protein psiE(psiE)

Recombinant Salmonella paratyphi C Protein psiE(psiE)

SKU:CSB-CF507178SWU

Regular price $1,725.00 USD
Regular price Sale price $1,725.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Salmonella paratyphi C (strain RKS4594)

Uniprot NO.:C0Q4D1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MMPLSRSRLEFIATILQNVLNLGLLTLGLILVVFLGKETVHLADALFAPEQASKYELVEG LVIYFLYFEFIALIVKYFKSGLHFPLRYFVYIGITAIVRLIIVDHKTPMDVLLYSAAILL LVITLWLCNSNRLRRE

Protein Names:Recommended name: Protein psiE

Gene Names:Name:psiE Ordered Locus Names:SPC_4287

Expression Region:1-136

Sequence Info:full length protein

View full details