Skip to product information
1 of 1

Gene Bio Systems

Recombinant Salmonella paratyphi B Electron transport complex protein RnfE(rnfE)

Recombinant Salmonella paratyphi B Electron transport complex protein RnfE(rnfE)

SKU:CSB-CF435705STF

Regular price $1,904.00 USD
Regular price Sale price $1,904.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)

Uniprot NO.:A9N028

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSEIKDIVVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTVSALR RWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPWLSALDGFSIGMGATGAMFVLGSLREILGNGTLFDGADSLLGGWAKVLRVEIFHTD SPFLLAMLPPGAFIGLGLMLAVKYLIDEKMKKRRAETAPSAVPAGETGKV

Protein Names:Recommended name: Electron transport complex protein RnfE

Gene Names:Name:rnfE Ordered Locus Names:SPAB_01866

Expression Region:1-230

Sequence Info:full length protein

View full details