Skip to product information
1 of 1

Gene Bio Systems

Recombinant Salmonella paratyphi A Protein AaeX(aaeX)

Recombinant Salmonella paratyphi A Protein AaeX(aaeX)

SKU:CSB-CF718964SBM

Regular price $1,639.00 USD
Regular price Sale price $1,639.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Salmonella paratyphi A (strain ATCC 9150 / SARB42)

Uniprot NO.:Q5PJT7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRMLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Protein Names:Recommended name: Protein AaeX

Gene Names:Name:aaeX Ordered Locus Names:SPA3233

Expression Region:1-67

Sequence Info:full length protein

View full details