Skip to product information
1 of 1

Gene Bio Systems

Recombinant Salmonella heidelberg UPF0059 membrane protein yebN(yebN)

Recombinant Salmonella heidelberg UPF0059 membrane protein yebN(yebN)

SKU:CSB-CF479238SWQ

Regular price $1,858.00 USD
Regular price Sale price $1,858.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Salmonella heidelberg (strain SL476)

Uniprot NO.:B4TKG5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHYTATVLLAFGMSMDAFAASIGKGATLHKPKFSEALRTGLIFGAVETLTPLIGWGLGIL ASKFVLEWNHWIAFVLLIFLGGRMIIEGIRGGSDEDETPLRRHSFWLLVTTAIATSLDAM AVGVGLAFLQVNIIATALAIGCATLIMSTLGMMIGRFIGPMLGKRAEILGGVVLIGIGVQ ILWTHFHG

Protein Names:Recommended name: UPF0059 membrane protein yebN

Gene Names:Name:yebN Ordered Locus Names:SeHA_C2035

Expression Region:1-188

Sequence Info:full length protein

View full details