Gene Bio Systems
Recombinant Salmonella gallinarum Protein AaeX(aaeX)
Recombinant Salmonella gallinarum Protein AaeX(aaeX)
SKU:CSB-CF475261SWP
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Salmonella gallinarum (strain 287/91 / NCTC 13346)
Uniprot NO.:B5REW4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSLFPVIVVFGLSFPPIFFKLLLSLAIFWLVRRMLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV
Protein Names:Recommended name: Protein AaeX
Gene Names:Name:aaeX Ordered Locus Names:SG3256
Expression Region:1-67
Sequence Info:full length protein
