Skip to product information
1 of 1

Gene Bio Systems

Recombinant Salmonella enteritidis PT4 Spermidine export protein MdtJ(mdtJ)

Recombinant Salmonella enteritidis PT4 Spermidine export protein MdtJ(mdtJ)

SKU:CSB-CF473383SWO

Regular price $1,706.00 USD
Regular price Sale price $1,706.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Salmonella enteritidis PT4 (strain P125109)

Uniprot NO.:B5QUE4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFYWILLALAIATEITGTLSMKWASVGNGNAGFILMLVMITLSYIFLSFAVKKIALGVAY ALWEGIGILFITIFSVLLFDEALSTMKIAGLLTLVAGIVLIKSGTRKPGKPVKEATRATI

Protein Names:Recommended name: Spermidine export protein MdtJ

Gene Names:Name:mdtJ Ordered Locus Names:SEN1567

Expression Region:1-120

Sequence Info:full length protein

View full details