
Size: 20ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: S4JJH7
Gene Names: A673_03341
Organism: Salmonella enterica subsp. enterica serovar Enteritidis str. 2009K0958
AA Sequence: DVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKEYPKTAVNVVGYTDSTGSHDLNMRLSQQRADSVASSLITQGVDASRIRTSGMGPANPIASNSTAEGKAQNRRVEITLSPLQ
Expression Region: 82-220aa
Sequence Info: Partial
Source: Mammalian cell
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW: 18.6 kDa
Alternative Name(s):
Relevance:
Reference: McClelland M., Porwollik S., Desai P., Cheng P., Wollam A., Pepin K., Palsikar V.B., Fulton L., Fulton R., Delehaunty K., Fronick C., Godfrey J., Waligorski J., Appelbaum E., Tomlinson C., Warren W., Sodergren E., Weinstock G., Wilson R.K.Submitted (APR-2013)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.