Skip to product information
1 of 1

Gene Bio Systems

Recombinant Salmonella arizonae Probable intracellular septation protein A(yciB)

Recombinant Salmonella arizonae Probable intracellular septation protein A(yciB)

SKU:CSB-CF430404STE

Regular price $1,780.00 USD
Regular price Sale price $1,780.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)

Uniprot NO.:A9MPE0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKQFLDFLPLVVFFAFYKLYDIYAATSALIVATAIVLIYSWVRYRKIEKMALITFVLVAV FGGLTLFFHNDEFIKWKVTVIYALFAGALLMSQWVMKKPLIQRMLGKELALPQQIWSKLN LAWALFFIVCGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGVYIYRHLPQEDKS

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Name:yciB Ordered Locus Names:SARI_01219

Expression Region:1-179

Sequence Info:full length protein

View full details