Recombinant Salmo trutta  Cytochrome c oxidase subunit 1(mt-co1)

Recombinant Salmo trutta Cytochrome c oxidase subunit 1(mt-co1)

CSB-CF015072SWJ
Regular price
$1,083.00 USD
Sale price
$1,083.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Salmo trutta (Brown trout)

Uniprot NO.:P29653

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:FWFFGHPEVYILILPGFGMISHIVAYYSGKKEPFGYMGMVWAMMAIGLLGFIVWAHHMFT VGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGSIKWETPLLWALG

Protein Names:Recommended name: Cytochrome c oxidase subunit 1 EC= 1.9.3.1 Alternative name(s): Cytochrome c oxidase polypeptide I

Gene Names:Name:mt-co1 Synonyms:coi, coxi, mtco1

Expression Region:1-109

Sequence Info:full length protein

Your list is ready to share