Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Vacuolar transporter chaperone 1(VTC1)

Recombinant Saccharomyces cerevisiae Vacuolar transporter chaperone 1(VTC1)

SKU:CSB-CF336667SVG

Regular price $1,717.00 USD
Regular price Sale price $1,717.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:P40046

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SSAPLLQRTPGKKIALPTRVEPKVFFANERTFLSWLNFTVMLGGLGVGLLNFGDKIGRVS AGLFTFVAMGTMIYALVTYHWRAAAIRRRGSGPYDDRLGPTLLCFFLLVAVIINFILRLK YNDANTKL

Protein Names:Recommended name: Vacuolar transporter chaperone 1 Alternative name(s): Negative regulator of CDC42 protein 1 Phosphate metabolism protein 4

Gene Names:Name:VTC1 Synonyms:NRF1, PHM4 Ordered Locus Names:YER072W

Expression Region:2-129

Sequence Info:full length protein

View full details