Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Vacuolar protein sorting-associated protein 68(VPS68)

Recombinant Saccharomyces cerevisiae Vacuolar protein sorting-associated protein 68(VPS68)

SKU:CSB-CF612268SVG

Regular price $1,786.00 USD
Regular price Sale price $1,786.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:Q12016

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEADDHVSLFRFPFKIPTFRGIRKGGVYLSGALYALGFWIFLDAVLYSRYSNASDVHVTF IDWIPFLCSTLGTLIVNSIEKNRLLQGALSSDGGAFGSGVGDLDSSMAWQARTVLFFGFA LLAGGLSGSIVVLIIKFLVKDYNTYPTLGMGVNNVLGNVCILLSCVVLWIAQNVEDEYSY SLTL

Protein Names:Recommended name: Vacuolar protein sorting-associated protein 68

Gene Names:Name:VPS68 Ordered Locus Names:YOL129W

Expression Region:1-184

Sequence Info:full length protein

View full details