Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Uncharacterized protein YOR032W-A(YOR032W-A)

Recombinant Saccharomyces cerevisiae Uncharacterized protein YOR032W-A(YOR032W-A)

SKU:CSB-CF851579SVG

Regular price $1,489.00 USD
Regular price Sale price $1,489.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:Q8TGS1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRRALFIAGQTYLWLNLTHLLLIFSWSSTMAFSQSRRLLTPTVPCPTLLGIDFLILVLRH FDEIFI

Protein Names:Recommended name: Uncharacterized protein YOR032W-A

Gene Names:Ordered Locus Names:YOR032W-A

Expression Region:1-66

Sequence Info:full length protein

View full details