Gene Bio Systems
Recombinant Saccharomyces cerevisiae Uncharacterized protein YGL194C-A(YGL194C-A)
Recombinant Saccharomyces cerevisiae Uncharacterized protein YGL194C-A(YGL194C-A)
SKU:CSB-CF647266SVG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Uniprot NO.:Q2V2P6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSNKEITCIKPFKIIALILLIVLIINLSYKLFLRRYLKSTVIWCLGIANTDRNDMMWWQV SPLLERWVWQLVDNYESGYE
Protein Names:Recommended name: Uncharacterized protein YGL194C-A
Gene Names:Ordered Locus Names:YGL194C-A
Expression Region:1-80
Sequence Info:full length protein
