Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Syntaxin-8(SYN8)

Recombinant Saccharomyces cerevisiae Syntaxin-8(SYN8)

SKU:CSB-CF022904SVG

Regular price $1,926.00 USD
Regular price Sale price $1,926.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:P31377

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDVLKLGYELDQLSDLVEERTRLVSVLKLAPTSNDNVTLKRQLGSILELLQKCAPNDELISRYNTILDKIPDTAVDKELYRFQQQVARNTDEVSKESLKKVRFKNDDELTVMYKDDDEQDEESPLPSTHTPYKDEPLQSQLQSQSQPQPPQPMVSNQELFINQQQQLLEQDSHLGALSQSIGRTHDISLDLNNEIVSQNDSLLVDLENLIDNNGRNLNRASRSMHGFNNSRFKDNGNCVIILVLIVVLLLLLLVL

Protein Names:Recommended name: Syntaxin-8 Alternative name(s): SNARE protein related to mammalian syntaxin 8 ULP1-interacting protein 2

Gene Names:Name:SYN8 Synonyms:UIP2 Ordered Locus Names:YAL014C ORF Names:FUN34

Expression Region:1-255

Sequence Info:full length protein

View full details