Recombinant Saccharomyces cerevisiae  Putative uncharacterized protein YOR015W(YOR015W)

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YOR015W(YOR015W)

CSB-CF621461SVG
Regular price
$1,088.00 USD
Sale price
$1,088.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:Q12169

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPHFKRAAVYEEQKRTGKWGQLVEETKDRIPEYSNKTIAKISHLDNGCLWPEIKVSFSHH LSILQSMCLHFIISILFSKYIFVFLFAFLLPSAFPLFILHSTLFRKPCLSIIGFLKTKV

Protein Names:Recommended name: Putative uncharacterized protein YOR015W

Gene Names:Ordered Locus Names:YOR015W ORF Names:O2618, OR26.05, YOL303.5

Expression Region:1-119

Sequence Info:full length protein