Recombinant Saccharomyces cerevisiae  Putative uncharacterized protein YHR054W-A (YHR054W-A)

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YHR054W-A (YHR054W-A)

CSB-CF316804SVG
Regular price
$1,047.00 USD
Sale price
$1,047.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:P0CL33

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNILKTIRFISQSSMTSWFLQTCYRRGICRRCYTPLGSYMIFGIVHYFCSYHIGIGTHDL HFGS

Protein Names:Recommended name: Putative uncharacterized protein YHR054W-A

Gene Names:Ordered Locus Names:YHR054W-A

Expression Region:1-64

Sequence Info:full length protein