Recombinant Saccharomyces cerevisiae  Putative uncharacterized protein YCL021W-A(YCL021W-A)

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YCL021W-A(YCL021W-A)

CSB-CF847237SVG
Regular price
$1,096.00 USD
Sale price
$1,096.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:Q96VH3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVLTDAEELRSPVITSDMSFFDLESNHSSDSVHLLCEKYTHKLPIESESQTTFRLAPTKQ RLYRQSTLYVPLSLKQRVFLFTERVKSIWAGLPRCKPNKYFKVAFALAVLTPLAIWIFYI DFRVH

Protein Names:Recommended name: Putative uncharacterized protein YCL021W-A

Gene Names:Ordered Locus Names:YCL021W-A

Expression Region:1-125

Sequence Info:full length protein

Your list is ready to share