Gene Bio Systems
Recombinant Saccharomyces cerevisiae N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase(GPI12)
Recombinant Saccharomyces cerevisiae N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase(GPI12)
SKU:CSB-CF017975SVG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Uniprot NO.:P23797
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKMLRRTKVNFSKLLYKITKLAIVLTILYIYFTPKIVSRNNASLQHIFPHKYGDYEINLVIAHPDDEVMFFSPIISQLNSYFPRTVPFNIICLSKGNAEGLGETRVRELNESAALLLHNERAVSVQVMDFQDGMDEIWDIDSITSSLSQKIDIKNHNLNQIIVTFDSYGVSNHINHKSCYAAVKKLVDDYAQPKTKRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLISPFRRIIQALPPNTAAEKDKLSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFVNEFDVYTY
Protein Names:Recommended name: N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase EC= 3.5.1.89
Gene Names:Name:GPI12 Ordered Locus Names:YMR281W ORF Names:YM8021.07
Expression Region:1-304
Sequence Info:full length protein
