Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase(GPI12)

Recombinant Saccharomyces cerevisiae N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase(GPI12)

SKU:CSB-CF017975SVG

Regular price $1,989.00 USD
Regular price Sale price $1,989.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:P23797

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKMLRRTKVNFSKLLYKITKLAIVLTILYIYFTPKIVSRNNASLQHIFPHKYGDYEINLVIAHPDDEVMFFSPIISQLNSYFPRTVPFNIICLSKGNAEGLGETRVRELNESAALLLHNERAVSVQVMDFQDGMDEIWDIDSITSSLSQKIDIKNHNLNQIIVTFDSYGVSNHINHKSCYAAVKKLVDDYAQPKTKRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLISPFRRIIQALPPNTAAEKDKLSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFVNEFDVYTY

Protein Names:Recommended name: N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase EC= 3.5.1.89

Gene Names:Name:GPI12 Ordered Locus Names:YMR281W ORF Names:YM8021.07

Expression Region:1-304

Sequence Info:full length protein

View full details