Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1(OST1)

Recombinant Saccharomyces cerevisiae Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1(OST1)

SKU:CSB-CF020344SVG

Regular price $2,173.00 USD
Regular price Sale price $2,173.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:P41543

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AQYEPPATWENVDYKRTIDVSNAYISETIEITIKNIASEPATEYFTAFESGIFSKVSFFSAYFTNEATFLNSQLLANSTTAPGDDGESEIRYGIIQFPNAISPQEEVSLVIKSFYNTVGIPYPEHVGMSEEQHLLWETNRLPLSAYDTKKASFTLIGSSSFEEYHPPNDESLLGKANGNSFEFGPWEDIPRFSSNETLAIVYSHNAPLNQVVNLRRDIWLSHWASTIQFEEYYELTNKAAKLSKGFSRLELMKQIQTQNMRQTHFVTVLDMLLPEGATDHYFTDLVGLVSTSHAERDHFFIRPRFPIFGGWNYNFTVGWTNKLSDFLHVSSGSDEKFVASIPILNGPPDTVYDNVELSVFLPEGAEIFDIDSPVPFTNVSIETQKSYFDLNKGHVKLTFSYRNLISQVANGQVLIKYDYPKSSFFKKPLSIACYIFTALMGVFVLKTLNMNVTN

Protein Names:Recommended name: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 EC= 2.4.1.119 Alternative name(s): Oligosaccharyl transferase 64 kDa subunit Oligosaccharyl transferase subunit OST1 Oligosaccharyl transferase subunit alpha

Gene Names:Name:OST1 Synonyms:NLT1 Ordered Locus Names:YJL002C ORF Names:J1404

Expression Region:23-476

Sequence Info:full length protein

View full details