Gene Bio Systems
Recombinant Saccharomyces cerevisiae Cytochrome oxidase assembly protein 3, mitochondrial(COA3)
Recombinant Saccharomyces cerevisiae Cytochrome oxidase assembly protein 3, mitochondrial(COA3)
SKU:CSB-CF457271SVP
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain RM11-1a) (Baker's yeast)
Uniprot NO.:B3LQ47
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVLNPSKYQDTRTWKMTPAMIRARKPFFKGNMLGLTLLLGVTGSVYYYTYHFLHKDNDFA DVPIPPIDPQELEALKKEYEAKKKA
Protein Names:Recommended name: Cytochrome oxidase assembly protein 3, mitochondrial Alternative name(s): Cytochrome oxidase protein 10 Required for respiratory growth protein 10
Gene Names:Name:COA3 Synonyms:COX25, RRG10 ORF Names:SCRG_03606
Expression Region:1-85
Sequence Info:full length protein
