Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 5, mitochondrial(AIM5)

Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 5, mitochondrial(AIM5)

SKU:CSB-CF511318SVL

Regular price $1,688.00 USD
Regular price Sale price $1,688.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain JAY291) (Baker's yeast)

Uniprot NO.:C7GMW8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSKLGPLARSVKWTLSVGVIGSVFYLYRYSNNGYFYDHDATWLKQDHQVQDLVDRKEVVP GETRNRKLVVTDDGTAWSRTMGESIKDIWNEQIRNSVDWIYSWGKN

Protein Names:Recommended name: Altered inheritance of mitochondria protein 5, mitochondrial Alternative name(s): Found in mitochondrial proteome protein 51

Gene Names:Name:AIM5 Synonyms:FMP51 ORF Names:C1Q_01598

Expression Region:1-106

Sequence Info:full length protein

View full details