
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)
Uniprot NO.:A6ZRY0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVNFYDDVDESKSHGEFPLIPVVLQNSSELSVRTIPTGNEIIESVHLTKWLRKYRNALAS QLDRYEKGWQSKIANFRLQVQHVINYSRKNIFNVDSENKHTVVPGSLIALGAFFAGSIAV NRSNWGAKRLIFGHKSSILEKLCTSLPSRILLPWVLAAATFKYWAPQTSQNLVNATENDL LPADFVKSYHNTWKRIYEEGYVAKKCDLKRQIDQTLQKNIRYAREQLYEKLEQA
Protein Names:Recommended name: Altered inheritance of mitochondria protein 37, mitochondrial
Gene Names:Name:AIM37 ORF Names:SCY_4691
Expression Region:1-234
Sequence Info:full length protein
You may also like
-
Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 37, mitochondrial(AIM37)
- Regular price
- $1,342.00 USD
- Sale price
- $1,342.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 37, mitochondrial(AIM37)
- Regular price
- $1,342.00 USD
- Sale price
- $1,342.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 37, mitochondrial(AIM37)
- Regular price
- $1,342.00 USD
- Sale price
- $1,342.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 37, mitochondrial(AIM37)
- Regular price
- $1,342.00 USD
- Sale price
- $1,342.00 USD
- Regular price
-
- Unit price
- per
Sold out