Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 11(AIM11)

Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 11(AIM11)

SKU:CSB-CF509787SVL

Regular price $1,728.00 USD
Regular price Sale price $1,728.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain JAY291) (Baker's yeast)

Uniprot NO.:C7GRS7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIEEKKELKKRRVLQMARFYGAAAFTLITMRLISRAIKVRKCNVPSIFQQNYKLPPFSQR NEAMSALTYASAASIGTFSTLIFGFCWALDISTAREFVFKTREFMSLPQALETDTSMDEE TSKLTKQLQDLLSSENNK

Protein Names:Recommended name: Altered inheritance of mitochondria protein 11 Alternative name(s): Genetic interactor of prohibitins 8

Gene Names:Name:AIM11 Synonyms:GEP8 ORF Names:C1Q_03034

Expression Region:1-138

Sequence Info:full length protein

View full details