Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Accumulation of dyads protein 2(ADY2)

Recombinant Saccharomyces cerevisiae Accumulation of dyads protein 2(ADY2)

SKU:CSB-CF333089SVG

Regular price $1,906.00 USD
Regular price Sale price $1,906.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:P25613

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSDKEQTSGNTDLENAPAGYYSSHDNDVNGVAEDERPSHDSLGKIYTGGDNNEYIYIGRQ KFLKSDLYQAFGGTLNPGLAPAPVHKFANPAPLGLSAFALTTFVLSMFNARAQGITVPNV VVGCAMFYGGLVQLIAGIWEIALENTFGGTALCSYGGFWLSFAAIYIPWFGILEAYEDNE SDLNNALGFYLLGWAIFTFGLTVCTMKSTVMFFLLFFLLALTFLLLSIGHFANRLGVTRA GGVLGVVVAFIAWYNAYAGVATKQNSYVLARPFPLPSTERVIF

Protein Names:Recommended name: Accumulation of dyads protein 2 Alternative name(s): Ammonia transport outward protein 1

Gene Names:Name:ADY2 Synonyms:ATO1 Ordered Locus Names:YCR010C ORF Names:YCR10C

Expression Region:1-283

Sequence Info:full length protein

View full details