
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Uniprot NO.:Q68XP0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIYDFKAEIIKSKSSSSSKSGAHHWLLQRVTGVVLALCSFWLIYFMFTNKNNDINIIMWE FKKPFNIVILLITVTISLYHSVLGMRVVIEDYINCHKLRNTLIIIVKLFCILTIVAFIVA IFYSE
Protein Names:Recommended name: Succinate dehydrogenase hydrophobic membrane anchor subunit
Gene Names:Name:sdhD Ordered Locus Names:RT0116
Expression Region:1-125
Sequence Info:full length protein