Recombinant Rickettsia typhi  NADH-quinone oxidoreductase subunit K(nuoK)

Recombinant Rickettsia typhi NADH-quinone oxidoreductase subunit K(nuoK)

CSB-CF737915RNE
Regular price
$1,080.00 USD
Sale price
$1,080.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rickettsia typhi (strain ATCC VR-144 / Wilmington)

Uniprot NO.:Q68VV8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLKILNMNEYISLNHYLILSSLVFTIGMFGLFMHRKNIINILMSIELMLLAVNINFVAFS VYMQELSGQIFSIIILTVAAAETAIGLAILLIYFRNKGSIKITDINKMRG

Protein Names:Recommended name: NADH-quinone oxidoreductase subunit K EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit K NDH-1 subunit K

Gene Names:Name:nuoK Ordered Locus Names:RT0778

Expression Region:1-110

Sequence Info:full length protein