Gene Bio Systems
Recombinant Rickettsia rickettsii Probable intracellular septation protein A (A1G_03060)
Recombinant Rickettsia rickettsii Probable intracellular septation protein A (A1G_03060)
SKU:CSB-CF421636RNC
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Rickettsia rickettsii (strain Sheila Smith)
Uniprot NO.:A8GRX4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLKFLSEIGPVIAFFAGFFYGGGIQHATLYMLITSVICITLCYVIDKKVSKLSIISTTVL LVSGSITLISGDSMYIKIKPTILYVIFGIIFLMSGIRKNPFIKYALESIVRLKEESWITL SYRTAAFFFFMAVVNEVVWRNCSDETWVKFKVFGVIPITFIFILLQLPLLLKNKLPDSKI
Protein Names:Recommended name: Probable intracellular septation protein A
Gene Names:Ordered Locus Names:A1G_03060
Expression Region:1-180
Sequence Info:full length protein
