Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rickettsia conorii Uncharacterized protein RC0356(RC0356)

Recombinant Rickettsia conorii Uncharacterized protein RC0356(RC0356)

SKU:CSB-CF835806RMS

Regular price $1,896.00 USD
Regular price Sale price $1,896.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rickettsia conorii (strain ATCC VR-613 / Malish 7)

Uniprot NO.:Q92IR4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNSLFVLIKRELIVQNRINNIIKYLVIFFLFCIISTVLINSERDINKFGLIFSVICLLIS LIGFSSVIFKSDLEDGSLELLLSIVSHEKIILAKFFAIFISSTIGLVFVLPIIYVLFDKT LLEIIFFFSSVWMILVLSSSLVVLSGSVQCYFKKNANFVGTFIMPLLIPNIIMTGLILQD NNLQLIFIMIGINLVFLPISFFLSSCLIKNIYNIT

Protein Names:Recommended name: Uncharacterized protein RC0356

Gene Names:Ordered Locus Names:RC0356

Expression Region:1-215

Sequence Info:full length protein

View full details