Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rickettsia conorii SURF1-like protein(RC1113)

Recombinant Rickettsia conorii SURF1-like protein(RC1113)

SKU:CSB-CF842236RMS

Regular price $1,852.00 USD
Regular price Sale price $1,852.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rickettsia conorii (strain ATCC VR-613 / Malish 7)

Uniprot NO.:Q92GL0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKTNFLVFITFTILISLGFWQLSRLKEKKLFLASMQANLTSPAINLAEIQDGLPYHKVKI TGQFLPNKDIYLYGRRSMSSEKDGYYLVTPFKTIEDKVILVARGWFSNRNKNIITQATND RQHEIIGVTMPSEKTRIYLPANDIKNNVWLTLNLKETSKVLGLDLENFYIIAEGKDISNL DILLPLAINHLAAIRNDHLEYALTWFGLAISLIVIYVIYRRRYMAVDVIPRACSGIQKNN

Protein Names:Recommended name: SURF1-like protein

Gene Names:Ordered Locus Names:RC1113

Expression Region:1-240

Sequence Info:full length protein

View full details