Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rickettsia bellii Succinate dehydrogenase hydrophobic membrane anchor subunit(sdhD)

Recombinant Rickettsia bellii Succinate dehydrogenase hydrophobic membrane anchor subunit(sdhD)

SKU:CSB-CF631186RAAI

Regular price $1,558.00 USD
Regular price Sale price $1,558.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rickettsia bellii (strain RML369-C)

Uniprot NO.:Q1RHB6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTYDFRAEIVKAKNTGSAKSGSHHWLLQRITAIILVLCSLWLLYFTLANKNSDVNIIIWE LKRPINLIPLLIAVITSLYHAMLGMQVVIEDYISCNKLRNTLIIAVKLFSILTIVAFIVA VFYRG

Protein Names:Recommended name: Succinate dehydrogenase hydrophobic membrane anchor subunit

Gene Names:Name:sdhD Ordered Locus Names:RBE_1167

Expression Region:1-125

Sequence Info:full length protein

View full details