Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rickettsia bellii Putative Na(+)-H(+) antiporter nhaA homolog(nhaA)

Recombinant Rickettsia bellii Putative Na(+)-H(+) antiporter nhaA homolog(nhaA)

SKU:CSB-CF632210RAAI

Regular price $1,720.00 USD
Regular price Sale price $1,720.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rickettsia bellii (strain RML369-C)

Uniprot NO.:Q1RGL5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFISFVIIIILFILNYKQVKHLLYYTIVGVLLWVSMVEAGIHGTLCGAIIALFIPVNIKG QINSSFHKLEKLIQPFVNYFILPLFVFMNSGVLLKDFSFRSVCSSLTFGIILGLFIGKQL RSYAIFLSMREV

Protein Names:Recommended name: Putative Na(+)/H(+) antiporter nhaA homolog

Gene Names:Name:nhaA Ordered Locus Names:RBE_1418

Expression Region:1-132

Sequence Info:full length protein

View full details